Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | NFAT2 Rabbit mAb |
---|---|
Catalog No. | A19597 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0076 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 844-943 of human NFAT2 (O95644). |
---|---|
Sequence | PSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS |
Gene ID | |
Swiss Prot | |
Synonyms | NFAT2; NFATc; NF-ATC; NF-ATc1.2 |
Calculated MW | 101kDa |
Observed MW | 110kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87MG, K-562, Jurkat, 293T |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19597? Please let us know so that we can cite the reference in this datasheet.