제품 > 항체 > 단일클론항체(mAb)

NMDAR1 Rabbit mAb (A11699)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of lysates from Mouse brain, using NMDAR1 Rabbit mAb (A11699) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - NMDAR1 Rabbit mAb (A11699)

Confocal imaging of Mouse brain using NMDAR1 Rabbit mAb (A11699, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Immunofluorescence analysis of paraffin-embedded Mouse brain tissue using NMDAR1 Rabbit mAb (A11699) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunofluorescence analysis of paraffin-embedded Rat brain tissue using NMDAR1 Rabbit mAb (A11699) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	NMDAR1 Rabbit mAb
Catalog No.	A11699
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0684

Background

The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 800-900 of human NMDAR1 (Q05586).
Sequence	SRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
Gene ID
Swiss Prot
Synonyms	NR1; MRD8; GluN1; NMDA1; DEE101; NDHMSD; NDHMSR; NMD-R1; NMDAR1
Calculated MW	105kDa
Observed MW	120kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse brain
Cellular location	Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, postsynaptic density, synapse.
Customer validation	WB(Rattus norvegicus)