제품 > 항체 > 다중클론항체(pAb)

N-Myc/MYCN Rabbit pAb (A0499)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HeLa cells, using N-Myc/MYCN Rabbit pAb (A0499) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - N-Myc/MYCN Rabbit pAb (A0499)

Immunohistochemistry analysis of paraffin-embedded mouse brain using N-Myc/MYCN Rabbit pAb (A0499) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat brain using N-Myc/MYCN Rabbit pAb (A0499) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - N-Myc/MYCN Rabbit pAb (A0499)

Immunofluorescence analysis of paraffin-embedded mouse brain using N-Myc/MYCN Rabbit pAb (A0499) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded rat brain using N-Myc/MYCN Rabbit pAb (A0499) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	N-Myc/MYCN Rabbit pAb
Catalog No.	A0499
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 168-267 of human N-Myc/MYCN (NP_005369.2).
Sequence	AGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDED
Gene ID
Swiss Prot
Synonyms	NMYC; ODED; MODED; N-myc; bHLHe37; MYCNsORF; MYCNsPEP; N-Myc/MYCN
Calculated MW	50kDa
Observed MW	62kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa
Cellular location	Nucleus
Customer validation	(Human neuroblastoma) WB(Homo sapiens, Rattus norvegicus) IF(Homo sapiens)