제품 > 항체 > 다중클론항체(pAb)

NOTCH3 Rabbit pAb (A3115)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from 293T cells, using NOTCH3 Rabbit pAb (A3115) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunofluorescence - NOTCH3 Rabbit pAb (A3115)

Immunofluorescence analysis of NIH/3T3 cells using NOTCH3 Rabbit pAb (A3115) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using NOTCH3 Rabbit pAb (A3115) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using NOTCH3 Rabbit pAb (A3115) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	NOTCH3 Rabbit pAb
Catalog No.	A3115
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1520-1640 of human NOTCH3 (NP_000426.2).
Sequence	PPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPLEPPEPS
Gene ID
Swiss Prot
Synonyms	IMF2; LMNS; CASIL; CADASIL; CADASIL1; NOTCH3
Calculated MW	244kDa
Observed MW	90kDa/280kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T
Cellular location	Cell membrane, Nucleus, Single-pass type I membrane protein
Customer validation	(SW480, HEK293T,DLD-1) WB(Rattus norvegicus) IHC(Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus)