Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | NPSR1 Rabbit pAb |
---|---|
Catalog No. | A16619 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human NPSR1 (NP_001287863.1). |
---|---|
Sequence | SKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERHEMQILSKPEFI |
Gene ID | |
Swiss Prot | |
Synonyms | GPRA; NPSR; VRR1; ASRT2; PGR14; GPR154; NPSR1 |
Calculated MW | 43kDa |
Observed MW | 43kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse lung, Mouse thymus |
Cellular location | Cell membrane, Cytoplasm, Multi-pass membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.