Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | NRXN1 Rabbit pAb |
---|---|
Catalog No. | A10066 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 31-310 of human NRXN1 (NP_001129131.1). |
---|---|
Sequence | LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEIKFGLQCVLPVLLHDNDQGKYCCINTAKPLTEKDNNVEGLAHLMMGDQGKSK |
Gene ID | |
Swiss Prot | |
Synonyms | PTHSL2; SCZD17; Hs.22998 |
Calculated MW | 15kDa/46kDa/161kDa/164kDa/169kDa |
Observed MW | 162kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SH-SY5Y, HepG2, Mouse liver |
Cellular location | Cell junction, Cell membrane, Single-pass type I membrane protein, synapse |
Customer validation | WB(Homo sapiens, Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10066? Please let us know so that we can cite the reference in this datasheet.