제품 > 항체 > 다중클론항체(pAb)

NUSAP1 Rabbit pAb (A16000)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using NUSAP1 Rabbit pAb (A16000) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	NUSAP1 Rabbit pAb
Catalog No.	A16000
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 [PubMed 12963707]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of human NUSAP1 (NP_060924.4).
Sequence	MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTSA
Gene ID
Swiss Prot
Synonyms	LNP; ANKT; SAPL; BM037; NUSAP; Q0310; PRO0310p1; NUSAP1
Calculated MW	49kDa
Observed MW	49kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Jurkat, Mouse thymus
Cellular location	cytoplasm, mitotic spindle, nucleolus
Customer validation	WB(Homo sapiens)