Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ORAI1 Rabbit pAb |
---|---|
Catalog No. | A7412 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ORAI1 (NP_116179.2). |
---|---|
Sequence | MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFA |
Gene ID | |
Swiss Prot | |
Synonyms | IMD9; TAM2; ORAT1; CRACM1; TMEM142A; ORAI1 |
Calculated MW | 33kDa |
Observed MW | 32-55kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, MCF7, Mouse lung, Mouse testis, Mouse spleen, Rat lung, Rat liver |
Cellular location | Cell membrane, Cytoplasmic vesicle, Multi-pass membrane protein, autophagosome |
Customer validation | WB(Rattus norvegicus, Gallus gallus, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7412? Please let us know so that we can cite the reference in this datasheet.