제품 > 항체 > 다중클론항체(pAb)

ORAI1 Rabbit pAb (A7412)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using (A7412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	ORAI1 Rabbit pAb
Catalog No.	A7412
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a membrane calcium channel subunit that is activated by the calcium sensor STIM1 when calcium stores are depleted. This type of channel is the primary way for calcium influx into T-cells. Defects in this gene are a cause of immune dysfunction with T-cell inactivation due to calcium entry defect type 1 (IDTICED1).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ORAI1 (NP_116179.2).
Sequence	MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFA
Gene ID
Swiss Prot
Synonyms	IMD9; TAM2; ORAT1; CRACM1; TMEM142A; ORAI1
Calculated MW	33kDa
Observed MW	32-55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, MCF7, Mouse lung, Mouse testis, Mouse spleen, Rat lung, Rat liver
Cellular location	Cell membrane, Cytoplasmic vesicle, Multi-pass membrane protein, autophagosome
Customer validation	WB(Rattus norvegicus, Gallus gallus, Mus musculus)