제품 > 항체 > 다중클론항체(pAb)

OTUD6A Rabbit pAb (A16628)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using OTUD6A Rabbit pAb (A16628) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	OTUD6A Rabbit pAb
Catalog No.	A16628
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable thiol-dependent deubiquitinase. Predicted to be involved in protein deubiquitination. Orthologous to human OTUD6A (OTU deubiquitinase 6A).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human OTUD6A (Q6IE21).
Sequence	MSDTEQELQRVIRRHYREKRELQAHIQTLKASVPKNDKGRRKQMLADISRLEAEMEQRHKQELEKFGENPDSSVDSVTADLEKMNLENMPPRPPKAQKRRDRRAHQERRHQERMPAAQAEQLAANRREEEEKVA
Gene ID
Swiss Prot
Synonyms	Hshin6; EG408193; OTUD6A
Calculated MW	34kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse testis, Rat testis
Cellular location