Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Oryza sativa
Product name | OsBZR1 Rabbit pAb |
---|---|
Catalog No. | A16014 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 82-276 of Oryza sativa OsBZR1 (Q7XI96). |
---|---|
Sequence | PSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPW |
Gene ID | |
Swiss Prot | |
Synonyms | BZR1; OsBZR1; OsJ_24880; OsBZR1 |
Calculated MW | 32kDa |
Observed MW | 40kDa |
Reactivity | Oryza sativa |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | leaves (after flower), flowers, milk seeds |
Cellular location | cytoplasm, nucleus |
Customer validation | ChIP(Triticum aestivum) WB(Oryza sativa) Other(Oryza sativa) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16014? Please let us know so that we can cite the reference in this datasheet.