제품 > 항체 > 다중클론항체(pAb)

PBRM1 Rabbit pAb (A9878)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PBRM1 Rabbit pAb (A9878) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s.

ABclonal:Immunoprecipitation - PBRM1 Rabbit pAb (A9878)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg PBRM1 Rabbit pAb (A9878). Western blot was performed from the immunoprecipitate using PBRM1 Rabbit pAb (A9878) at a dilition of 1:500.

Overview

Product name	PBRM1 Rabbit pAb
Catalog No.	A9878
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human PBRM1 (NP_060783.3).
Sequence	MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDL
Gene ID
Swiss Prot
Synonyms	PB1; RCC; BAF180; SMARCH1; PBRM1
Calculated MW	193kDa
Observed MW	230kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, Jurkat, BT-474, NIH/3T3, LO2, Mouse lung, Mouse thymus, Rat liver
Cellular location	Nucleus
Customer validation	WB(Homo sapiens)