Review (1)Publications (53) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, African green monkey
Product name | PCNA Rabbit mAb |
---|---|
Catalog No. | A12427 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51324 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1). |
---|---|
Sequence | CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
Gene ID | |
Swiss Prot | |
Synonyms | ATLD2; PCNA |
Calculated MW | 29kDa |
Observed MW | 36kDa |
Reactivity | Human, Mouse, Rat, African green monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, 293T, MCF7, C2C12, C6 |
Cellular location | Nucleus. |
Customer validation | (H226) WB(Mus musculus, Homo sapiens, Mus musculus、Sus scrofa, Rattus norvegicus, Other) IHC(Rattus norvegicus, Homo sapiens, Mus musculus, Sus scrofa) IF(Mus musculus, Homo sapiens) WB(Mus musculus, Homo sapiens) IHC(Homo sapiens) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A12427? Please let us know so that we can cite the reference in this datasheet.