Review (1)Publications (46) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, African green monkey
Western blot analysis of various lysates using PCNA Rabbit mAb (A12427) at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using PCNA Rabbit mAb (A12427) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | PCNA Rabbit mAb |
|---|---|
| Catalog No. | A12427 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC51324 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1). |
|---|---|
| Sequence | CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ATLD2; PCNA |
| Calculated MW | 29kDa |
| Observed MW | 36kDa |
| Reactivity | Human, Mouse, Rat, African green monkey |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HeLa, 293T, MCF7, C2C12, C6 |
| Cellular location | Nucleus. |
| Customer validation | (H226) WB(Mus musculus, Homo sapiens, Mus musculus、Sus scrofa, Rattus norvegicus, Other) IHC(Rattus norvegicus, Homo sapiens, Mus musculus) IF(Mus musculus, Homo sapiens) WB(Mus musculus) IHC(Homo sapiens) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A12427? Please let us know so that we can cite the reference in this datasheet.
