제품 > 항체 > 단일클론항체(mAb)

PDCD7 Rabbit mAb (A1510)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PDCD7 Rabbit mAb (A1510) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from Rat brain, using PDCD7 Rabbit mAb (A1510) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PDCD7 Rabbit mAb (A1510)

Immunohistochemistry analysis of PDCD7 in paraffin-embedded human breast cancer tissue using PDCD7 Rabbit mAb (A1510) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PDCD7 in paraffin-embedded human breast tissue using PDCD7 Rabbit mAb (A1510) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PDCD7 in paraffin-embedded human small intestine tissue using PDCD7 Rabbit mAb (A1510) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PDCD7 in paraffin-embedded mouse intestin tissue using PDCD7 Rabbit mAb (A1510) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PDCD7 in paraffin-embedded human esophagus tissue using PDCD7 Rabbit mAb (A1510) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PDCD7 in paraffin-embedded rat liver tissue using PDCD7 Rabbit mAb (A1510) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	PDCD7 Rabbit mAb
Catalog No.	A1510
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2564

Background

This gene encodes a 59 kDa protein that is associated with the U11 small nuclear ribonucleoprotein (snRNP), which is a component of the minor U12-type spliceosome responsible for catalyzing pre-mRNA splicing of U12-type introns.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDCD7 (Q8N8D1).
Sequence	MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPG
Gene ID
Swiss Prot
Synonyms	59K; ES18; HES18; PDCD7
Calculated MW	55kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	TE-1, SK-OV-3, Mouse testis, Mouse thymus, Rat brain
Cellular location	Nucleus