제품 > 항체 > 다중클론항체(pAb)

PDK1/PDHK1 Rabbit pAb (A0834)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PDK1/PDHK1 antibody (A0834) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of extracts of HepG2 cells, using PDK1/PDHK1 antibody (A0834) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - PDK1/PDHK1 Rabbit pAb (A0834)

Immunofluorescence analysis of NIH/3T3 cells using PDK1/PDHK1 Rabbit pAb (A0834) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using PDK1/PDHK1 Rabbit pAb (A0834) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review

Overview

Product name	PDK1/PDHK1 Rabbit pAb
Catalog No.	A0834
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1).
Sequence	STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
Gene ID
Swiss Prot
Synonyms	PDK1
Calculated MW	49kDa
Observed MW	49kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HepG2, Mouse brain, Mouse heart, Rat heart
Cellular location	Mitochondrion matrix
Customer validation	(unknow) WB(Mus musculus, Homo sapiens)