Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | PDLIM3 Rabbit pAb |
---|---|
Catalog No. | A6346 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-230 of human PDLIM3 (NP_001107579.1). |
---|---|
Sequence | KAAAHQLCLKIDRGETHLWSPQVSEDGKAHPFKINLESEPQEFKPIGTAHNRRAQPFVAAANIDDKRQVVSASYNSPIGLYSTSNIQDALHGQLRGLIPSSPQNEPTASVPPESDVYRMLHDNRNEPTQPRQSGSFRVLQGMVDDGSDDRPAGTRSVRAPV |
Gene ID | |
Swiss Prot | |
Synonyms | ALP |
Calculated MW | 39kDa |
Observed MW | 35kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse lung |
Cellular location | Cytoplasm, Z line, myofibril, sarcomere |
Customer validation | WB(Homo sapiens, Mus musculus, Gallus gallus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A6346? Please let us know so that we can cite the reference in this datasheet.