제품 > 항체 > 단일클론항체(mAb)

PDXK Rabbit mAb (A23085)

Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human

ABclonal:Western blot - PDXK Rabbit mAb (A23085)

Western blot analysis of various lysates, using PDXK Rabbit mAb (A23085) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product namePDXK Rabbit mAb
Catalog No.A23085
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
CloneNo.ARC59845
The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 1-312 of human PDXK (NP_003672.1).
Sequence MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Gene ID
Swiss Prot
SynonymsPKH; PNK; HMSN6C; PRED79; C21orf97; HEL-S-1a; C21orf124; PDXK
Calculated MW35kDa
Observed MW36kDa
ReactivityHuman
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage bufferStore at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key applicationWestern blotting    
Positive samplesHeLa, U-251 MG, MOLT-4
Cellular locationCytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

    ABclonal:Western blot - PDXK Rabbit mAb (A23085)}

    Western blot - PDXK Rabbit mAb (A23085)

    Western blot analysis of various lysates, using PDXK Rabbit mAb (A23085) at 1:1000 dilution.
    Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
    Lysates/proteins: 25μg per lane.
    Blocking buffer: 3% nonfat dry milk in TBST.
    Detection: ECL Basic Kit (RM00020).
    Exposure time: 90s.

    * For research use only. Not for therapeutic or diagnostic purposes.

    항체 (3)

    Secondary Antibodies (24)