제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse IL-9 mAb (A26265)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were intracellularly-stained with PE Rabbit anti-Mouse IL-9 mAb (A26265, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were intracellularly-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse IL-9 mAb (A26265, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Mouse IL-9 mAb
Catalog No.	A26265
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68959-PE

Background

Enables cytokine activity. Involved in positive regulation of interleukin-5 production. Acts upstream of or within several processes, including B cell activation; regulation of cellular protein metabolic process; and regulation of receptor signaling pathway via JAK-STAT. Located in extracellular space. Is expressed in gut; liver; thymus; and thymus primordium. Human ortholog(s) of this gene implicated in asthma and respiratory syncytial virus infectious disease. Orthologous to human IL9 (interleukin 9).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-114 of mouse IL-9 (NP_032399.1).
Sequence	QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCN
Gene ID
Swiss Prot
Synonyms	P40; Il-9
Calculated MW	16kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Secreted.