제품 > 항체 > 다중클론항체(pAb)

PFKFB2 Rabbit pAb (A9311)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PFKFB2 antibody (A9311) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - PFKFB2 Rabbit pAb (A9311)

Immunofluorescence analysis of C6 cells using PFKFB2 Rabbit pAb (A9311) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using PFKFB2 Rabbit pAb (A9311) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	PFKFB2 Rabbit pAb
Catalog No.	A9311
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is involved in both the synthesis and degradation of fructose-2, 6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2, 6-bisphosphate, and a fructose-2, 6-biphosphatase activity that catalyzes the degradation of fructose-2, 6-bisphosphate. This protein regulates fructose-2, 6-bisphosphate levels in the heart, while a related enzyme encoded by a different gene regulates fructose-2, 6-bisphosphate levels in the liver and muscle. This enzyme functions as a homodimer. Two transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 446-505 of human PFKFB2 (NP_006203.2).
Sequence	RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD
Gene ID
Swiss Prot
Synonyms	PFK-2/FBPase-2
Calculated MW	58kDa
Observed MW	54kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-549, Mouse liver, Mouse brain, Mouse skeletal muscle, Rat liver
Cellular location	cytosol, nucleoplasm
Customer validation	WB(Mus musculus, Homo sapiens)