제품 > 항체 > 다중클론항체(pAb)

PFN2 Rabbit pAb (A3074)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PFN2 antibody (A3074) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	PFN2 Rabbit pAb
Catalog No.	A3074
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-140 of human PFN2 (P35080).
Sequence	NVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Gene ID
Swiss Prot
Synonyms	PFL; D3S1319E
Calculated MW	15kDa
Observed MW	15kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SW480, BT-474, U-251MG, Mouse skeletal muscle, Mouse kidney, Rat brain
Cellular location	Cytoplasm, cytoskeleton
Customer validation	WB(Homo sapiens, Rattus norvegicus)