제품 > 항체 > 단일클론항체(mAb)

PGAM1 Rabbit mAb (A4170)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PGAM1 Rabbit mAb (A4170) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - PGAM1 Rabbit mAb (A4170)

Immunohistochemistry analysis of paraffin-embedded Human appendix using PGAM1 Rabbit mAb (A4170) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	PGAM1 Rabbit mAb
Catalog No.	A4170
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0913

Background

The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PGAM1 (P18669).
Sequence	MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNK
Gene ID
Swiss Prot
Synonyms	PGAMA; PGAM-B; HEL-S-35; PGAM1
Calculated MW	29kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:100 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, HepG2, U-251MG, Mouse liver, Mouse brain, Mouse kidney, Rat brain, Rat spleen, Rat kidney
Cellular location	cytoplasm, cytosol, extracellular exosome, extracellular region.
Customer validation	IHC(Rattus norvegicus, Mus musculus, Homo sapiens) WB(Homo sapiens) WB(Gallus gallus)