Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | PI3 Kinase p110 beta Rabbit mAb |
---|---|
Catalog No. | A22467 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54484 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 410-600 of human PI3 Kinase p110 beta (NP_006210.1). |
---|---|
Sequence | KVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK |
Gene ID | |
Swiss Prot | |
Synonyms | PI3K; PIK3C1; P110BETA; PI3KBETA; PI3 Kinase p110 beta |
Calculated MW | 123kDa |
Observed MW | 123kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | K-562, 293F, Mouse brain, Mouse placenta, Rat brain, Rat lung |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22467? Please let us know so that we can cite the reference in this datasheet.