제품 > 항체 > 다중클론항체(pAb)

PI3 Rabbit pAb (A5441)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using PI3 Rabbit pAb (A5441) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunohistochemistry - PI3 Rabbit pAb (A5441)

Immunohistochemistry analysis of paraffin-embedded Human colon using PI3 Rabbit pAb (A5441) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse lung using PI3 Rabbit pAb (A5441) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	PI3 Rabbit pAb
Catalog No.	A5441
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-117 of human PI3 (NP_002629.1).
Sequence	AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Gene ID
Swiss Prot
Synonyms	ESI; WAP3; SKALP; WFDC14; cementoin; PI3
Calculated MW	12kDa
Observed MW	12kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	U-87MG, HepG2
Cellular location	Secreted
Customer validation	WB(Homo sapiens, Mus musculus)