Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Immunohistochemistry analysis of PI 3 Kinase catalytic subunit gamma in paraffin-embedded Human tonsil tissue using PI 3 Kinase catalytic subunit gamma Rabbit pAb (A25468) at a dilution of 1:1200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of PI 3 Kinase catalytic subunit gamma in paraffin-embedded Human colon tissue using PI 3 Kinase catalytic subunit gamma Rabbit pAb (A25468) at a dilution of 1:1200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | PIK3CG Rabbit pAb |
|---|---|
| Catalog No. | A25468 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 201-330 of human PIK3CG (NP_002640.2). |
|---|---|
| Sequence | WVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCT |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PI3K; PIK3; IMD97; PI3CG; PI3Kgamma; p110gamma; p120-PI3K; PIK3CG |
| Calculated MW | 126kDa |
| Observed MW | Refer to figures |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Immunohistochemistry |
| Positive samples | |
| Cellular location | Cell membrane, Cytoplasm |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
