Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | PLA2G16 Rabbit pAb |
---|---|
Catalog No. | A16018 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 68-162 of human PLA2G16 (NP_009000.2). |
---|---|
Sequence | VAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ |
Gene ID | |
Swiss Prot | |
Synonyms | AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1 |
Calculated MW | 18kDa |
Observed MW | 18kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2, HT-29 |
Cellular location | cytoplasm, cytosol, endoplasmic reticulum, lysosome, mitochondrial membrane, mitochondrion, nuclear envelope, perinuclear region of cytoplasm, peroxisome, plasma membrane |
Customer validation | WB(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16018? Please let us know so that we can cite the reference in this datasheet.