Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | PLA2G4A Rabbit pAb |
---|---|
Catalog No. | A0394 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 550-749 of human PLA2G4A (NP_077734.1). |
---|---|
Sequence | SGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYKAPGVPRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSKPKA |
Gene ID | |
Swiss Prot | |
Synonyms | GURDP; cPLA2; PLA2G4; cPLA2-alpha; PLA2G4A |
Calculated MW | 85kDa |
Observed MW | 115kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | THP-1, NCI-H460, HT-29, HepG2, Mouse liver, Mouse lung |
Cellular location | Cytoplasm, Cytoplasmic vesicle. |
Customer validation | WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0394? Please let us know so that we can cite the reference in this datasheet.