Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | PLC gamma 1 (PLCG1) Rabbit pAb |
---|---|
Catalog No. | A15704 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1202-1291 of human PLC gamma 1 (PLC gamma 1 (PLCG1)) (NP_002651.2). |
---|---|
Sequence | LASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL |
Gene ID | |
Swiss Prot | |
Synonyms | PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1; PLC gamma 1 (PLCG1) |
Calculated MW | 149kDa |
Observed MW | 149kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | MCF7 |
Cellular location | Cell projection, lamellipodium, ruffle. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.