Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PLXNB2 Rabbit pAb |
---|---|
Catalog No. | A10069 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1080-1200 of human PLXNB2 (NP_036533.2). |
---|---|
Sequence | ALLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLNKAMTLQEAEAFVGAERCTMKTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSL |
Gene ID | |
Swiss Prot | |
Synonyms | MM1; PLEXB2; lncFAL; Nbla00445; dJ402G11.3 |
Calculated MW | 205kDa |
Observed MW | 80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat, SH-SY5Y, SKOV3, HepG2, 22Rv1, Mouse brain, Mouse liver, Mouse kidney, Rat liver |
Cellular location | Cell membrane, Single-pass type I membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.