제품 > 항체 > 다중클론항체(pAb)

PLXNB2 Rabbit pAb (A10069)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PLXNB2 antibody (A10069) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	PLXNB2 Rabbit pAb
Catalog No.	A10069
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Members of the B class of plexins, such as PLXNB2 are transmembrane receptors that participate in axon guidance and cell migration in response to semaphorins (Perrot et al. (2002) [PubMed 12183458]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1080-1200 of human PLXNB2 (NP_036533.2).
Sequence	ALLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLNKAMTLQEAEAFVGAERCTMKTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSL
Gene ID
Swiss Prot
Synonyms	MM1; PLEXB2; lncFAL; Nbla00445; dJ402G11.3
Calculated MW	205kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Jurkat, SH-SY5Y, SKOV3, HepG2, 22Rv1, Mouse brain, Mouse liver, Mouse kidney, Rat liver
Cellular location	Cell membrane, Single-pass type I membrane protein