Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using PMAIP1 Rabbit pAb (A9801) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of Jurkat cells using PMAIP1 antibody (A9801) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat thymus cells using PMAIP1 antibody (A9801) at dilution of 1:100. Blue: DAPI for nuclear staining.
| Product name | PMAIP1 Rabbit pAb |
|---|---|
| Catalog No. | A9801 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-54 of human PMAIP1 (NP_066950.1). |
|---|---|
| Sequence | MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT |
| Gene ID | |
| Swiss Prot | |
| Synonyms | APR; NOXA |
| Calculated MW | 6kDa |
| Observed MW | 15kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | 293F |
| Cellular location | Mitochondrion |
| Customer validation | WB(Homo sapiens, Ovis aries, Mus musculus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9801? Please let us know so that we can cite the reference in this datasheet.
