제품 > 항체 > 다중클론항체(pAb)

PNPO Rabbit pAb (A18495)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PNPO Rabbit pAb (A18495) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - PNPO Rabbit pAb (A18495)

Immunofluorescence analysis of L929 cells using PNPO Rabbit pAb (A18495) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using PNPO Rabbit pAb (A18495) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	PNPO Rabbit pAb
Catalog No.	A18495
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5'-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human PNPO (NP_060599.1).
Sequence	MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
Gene ID
Swiss Prot
Synonyms	PDXPO; HEL-S-302; PNPO
Calculated MW	30kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HepG2, 293T, Mouse brain, Mouse kidney, Mouse liver, Rat brain, Rat kidney, Rat liver
Cellular location	cytosol
Customer validation	WB(Mus musculus, Homo sapiens)