제품 > 항체 > 다중클론항체(pAb)

PP2A-Aα/PR65α/PPP2R1A Rabbit pAb (A5799)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PP2A-Aalpha/PR65α/PP2A-Aα/PR65α/PPP2R1A Polyclonal Antibody (A5799) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - PP2A-Aα/PR65α/PPP2R1A Rabbit pAb (A5799)

Immunofluorescence analysis of U2OS cells using PP2A-Aalpha/PR65α/PP2A-Aα/PR65α/PPP2R1A antibody (A5799). Blue: DAPI for nuclear staining.

Overview

Product name	PP2A-Aα/PR65α/PPP2R1A Rabbit pAb
Catalog No.	A5799
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PP2A-Aalpha/PR65α/PP2A-Aα/PR65α/PPP2R1A (NP_055040.2).
Sequence	MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTEL
Gene ID
Swiss Prot
Synonyms	MRD36; PP2AA; PR65A; PP2AAALPHA; PP2A-Aalpha
Calculated MW	65kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:10 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7, HT-29, Mouse liver, Mouse brain, Mouse kidney, Rat liver, Rat brain
Cellular location	Chromosome, Cytoplasm, centromere
Customer validation	WB(Sus scrofa)