Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat
Western blot analysis of various lysates using PPARγ Rabbit mAb (A19676) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
| Product name | PPARγ Rabbit mAb |
|---|---|
| Catalog No. | A19676 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0155 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPARγ (P37231). |
|---|---|
| Sequence | LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH |
| Gene ID | |
| Swiss Prot | |
| Synonyms | GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma; PPARγ |
| Calculated MW | 58kDa |
| Observed MW | 70kDa |
| Reactivity | Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Rat liver, Rat heart |
| Cellular location | Cytoplasm, Nucleus. |
| Customer validation | WB(Mus musculus, Homo sapiens, Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19676? Please let us know so that we can cite the reference in this datasheet.
