Review (1)Publication (1) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PPIA Rabbit pAb |
---|---|
Catalog No. | A0993 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-165 of human PPIA (NP_066953.1). |
---|---|
Sequence | MANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Gene ID | |
Swiss Prot | |
Synonyms | CYPA; CYPH; HEL-S-69p; PPIA |
Calculated MW | 18kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | K-562, Jurkat, HepG2, HeLa, NIH/3T3, Mouse lung, mouse spleen, rat spleen, mouse brain, rat brain |
Cellular location | Cytoplasm, Secreted. |
Customer validation | (HepG2) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A0993? Please let us know so that we can cite the reference in this datasheet.