PTHLH Rabbit pAb (A12492)

Publications (4) Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Overview

Product name	PTHLH Rabbit pAb
Catalog No.	A12492
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 74-130 of human PTHLH (NP_945316.1).
Sequence	ATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKP
Gene ID
Swiss Prot
Synonyms	HHM; PLP; BDE2; PTHR; PTHRP
Calculated MW	20kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples
Cellular location	Cytoplasm, Nucleus, Secreted
Customer validation	WB(Homo sapiens, Mus musculus, Gallus gallus) IF(Homo sapiens, Gallus gallus) IHC(Mus musculus, Gallus gallus)