제품 > 항체 > 다중클론항체(pAb)

PXR Rabbit pAb (A17038)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PXR Rabbit pAb (A17038) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - PXR Rabbit pAb (A17038)

Immunofluorescence analysis of C6 cells using PXR Rabbit pAb (A17038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - PXR Rabbit pAb (A17038)

Immunoprecipitation analysis of 600 μg extracts of Mouse stomach cells using 3 μg PXR antibody (A17038). Western blot was performed from the immunoprecipitate using PXR antibody (A17038) at a dilution of 1:500.

Overview

Product name	PXR Rabbit pAb
Catalog No.	A17038
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 135-230 of human PXR (NP_003880.3).
Sequence	TQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPAD
Gene ID
Swiss Prot
Synonyms	BXR; PAR; PRR; PXR; SAR; SXR; ONR1; PAR1; PAR2; PARq
Calculated MW	50kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HT-29, HepG2, SW480, Mouse large intestine, Mouse liver, Mouse stomach, Rat kidney
Cellular location	Nucleus.
Customer validation	IF(Homo sapiens,Mus musculus) IP(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus)