제품 > 항체 > 단일클론항체(mAb)

Peroxiredoxin 3 (PRDX3) Rabbit mAb (A2398)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Peroxiredoxin 3 (PRDX3) Rabbit mAb (A2398) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Peroxiredoxin 3 (PRDX3) Rabbit mAb (A2398)

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Peroxiredoxin 3 (PRDX3) Rabbit mAb (A2398) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Peroxiredoxin 3 (PRDX3) Rabbit mAb (A2398) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Peroxiredoxin 3 (PRDX3) Rabbit mAb (A2398)

Confocal imaging of U-2 OS cells using Peroxiredoxin 3 (PRDX3) Rabbit mAb (A2398, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	Peroxiredoxin 3 (PRDX3) Rabbit mAb
Catalog No.	A2398
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0747

Background

This gene encodes a mitochondrial protein with antioxidant function. The protein is similar to the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase, and it can rescue bacterial resistance to alkylhydroperoxide in E. coli that lack the C22 subunit. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologs suggest that these genes consist of a family that is responsible for the regulation of cellular proliferation, differentiation and antioxidant functions. This family member can protect cells from oxidative stress, and it can promote cell survival in prostate cancer. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 3, 13 and 22.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (PRDX3) (P30048).
Sequence	NIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ
Gene ID
Swiss Prot
Synonyms	AOP1; MER5; AOP-1; PPPCD; SP-22; HBC189; SCAR32; PRO1748; prx-III; Peroxiredoxin 3 (PRDX3)
Calculated MW	28kDa
Observed MW	25kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Hep G2, MCF7, U-87MG, Mouse liver
Cellular location	Mitochondrion, Cytoplasm, Endosome.
Customer validation	WB(Homo sapiens)