Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Peroxiredoxin 3 (PRDX3) Rabbit mAb |
---|---|
Catalog No. | A2398 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0747 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (PRDX3) (P30048). |
---|---|
Sequence | NIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ |
Gene ID | |
Swiss Prot | |
Synonyms | AOP1; MER5; AOP-1; PPPCD; SP-22; HBC189; SCAR32; PRO1748; prx-III; Peroxiredoxin 3 (PRDX3) |
Calculated MW | 28kDa |
Observed MW | 25kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Hep G2, MCF7, U-87MG, Mouse liver |
Cellular location | Mitochondrion, Cytoplasm, Endosome. |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2398? Please let us know so that we can cite the reference in this datasheet.