Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | Pro-MMP9 Rabbit mAb |
---|---|
Catalog No. | A23919 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC62081 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-107 of mouse MMP9(NP_038627.1). |
---|---|
Sequence | APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGR |
Gene ID | |
Swiss Prot | |
Synonyms | Clg4b; Gel B; MMP-9; B/MMP9; pro-MMP-9; Pro-MMP9 |
Calculated MW | 80KDa |
Observed MW | 40kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse Pro-MMP9 protein |
Cellular location | Secreted, Extracellular space, Extracellular matrix. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23919? Please let us know so that we can cite the reference in this datasheet.