제품 > 항체 > 다중클론항체(pAb)

Prohibitin 2 (PHB2) Rabbit pAb (A4504)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Prohibitin 2 (PHB2) Rabbit pAb (A4504) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Prohibitin 2 (PHB2) Rabbit pAb (A4504)

Immunohistochemistry analysis of paraffin-embedded Human esophagus using Prohibitin 2 (PHB2) Rabbit pAb (A4504) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - Prohibitin 2 (PHB2) Rabbit pAb (A4504)

Immunoprecipitation analysis of 300 μg extracts of A-549 cells using 3 μg Prohibitin 2 (PHB2) antibody (A4504). Western blot was performed from the immunoprecipitate using Prohibitin 2 (PHB2) antibody (A4504) at a dilution of 1:1000.

Overview

Product name	Prohibitin 2 (PHB2) Rabbit pAb
Catalog No.	A4504
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including protein C-terminus binding activity; protein N-terminus binding activity; and protein dimerization activity. Involved in several processes, including defense response to virus; positive regulation of cell cycle phase transition; and regulation of transcription, DNA-templated. Located in several cellular components, including cell surface; mitochondrial membrane; and nuclear matrix. Part of mitochondrial prohibitin complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-299 of human Prohibitin 2 (Prohibitin 2 (PHB2)) (NP_001138303.1).
Sequence	MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Gene ID
Swiss Prot
Synonyms	BAP; REA; p22; hBAP; Bap37; BCAP37; PNAS-141; Prohibitin 2 (PHB2)
Calculated MW	33kDa
Observed MW	32kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	BT-474, 22Rv1, 293T, HepG2, A-549, Mouse heart, Mouse liver, Rat heart, Rat liver
Cellular location	Cytoplasm, Mitochondrion inner membrane, Nucleus
Customer validation	WB(Rattus norvegicus)