제품 > 항체 > 다중클론항체(pAb)

RAB26 Rabbit pAb (A16509)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RAB26 Rabbit pAb (A16509) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	RAB26 Rabbit pAb
Catalog No.	A16509
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by Seki et al., 2000 [PubMed 11043516]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human RAB26 (NP_055168.2).
Sequence	MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY
Gene ID
Swiss Prot
Synonyms	V46133; RAB26
Calculated MW	28kDa
Observed MW	26kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, Mouse pancreas, Rat kidney
Cellular location	Cytoplasmic side, Cytoplasmic vesicle, Golgi apparatus membrane, Lipid-anchor, secretory vesicle membrane