제품 > 항체 > 단일클론항체(mAb)

RAB5A Rabbit mAb (A23955)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse brain, using RAB5A Rabbit mAb (A23955) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - RAB5A Rabbit mAb (A23955)

Immunohistochemistry analysis of paraffin-embedded Rat liver using RAB5A Rabbit mAb (A23955) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney using RAB5A Rabbit mAb (A23955) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using RAB5A Rabbit mAb (A23955) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	RAB5A Rabbit mAb
Catalog No.	A23955
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62486

Background

RAB5A (RAB5A, member RAS oncogene family) is a protein-coding gene. Diseases associated with RAB5A include borna disease, and venezuelan equine encephalitis. GO annotations related to this gene include GDP binding and GTP binding. An important paralog of this gene is RAB20.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 115-215 of human RAB5A (NP_004153.2).
Sequence	VKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Gene ID
Swiss Prot
Synonyms	RAB5A; RAB5; ras-related protein Rab-5A
Calculated MW	22kDa/23kDa
Observed MW	27kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse brain
Cellular location	Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Early endosome membrane, Lipid-anchor, Melanosome, Membrane, cytosol, ruffle.