Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using RACK1 Rabbit mAb (A3808) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates using RACK1 Rabbit mAb (A3808) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
| Product name | RACK1 Rabbit mAb |
|---|---|
| Catalog No. | A3808 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0837 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human RACK1 (P63244). |
|---|---|
| Sequence | DLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H12.3; HLC-7; PIG21; GNB2L1; Gnb2-rs1; RACK1 |
| Calculated MW | 35kDa |
| Observed MW | 32kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Rat brain, Rat spleen, Rat kidney, 293T, HepG2, Jurkat, Mouse brain, Mouse spleen, Mouse kidney |
| Cellular location | Cell membrane, Cell projection, Cytoplasm, Nucleus, Perikaryon, Peripheral membrane protein, cytoskeleton, dendrite, perinuclear region, phagocytic cup. |
| Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3808? Please let us know so that we can cite the reference in this datasheet.
