제품 > 항체 > 다중클론항체(pAb)

RBL2 Rabbit pAb (A13649)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of Neuro-2a cells, using RBL2 antibody (A13649) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.

ABclonal:Immunofluorescence - RBL2 Rabbit pAb (A13649)

Immunofluorescence analysis of U2OS cells using RBL2 Rabbit pAb (A13649) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	RBL2 Rabbit pAb
Catalog No.	A13649
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables promoter-specific chromatin binding activity. Involved in regulation of lipid kinase activity. Acts upstream of or within negative regulation of gene expression. Located in chromosome; cytosol; and nuclear lumen.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 413-613 of human RBL2 (NP_005602.3).
Sequence	SPCVTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNE
Gene ID
Swiss Prot
Synonyms	Rb2; P130; BRUWAG
Calculated MW	128kDa
Observed MW	130kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Neuro-2a
Cellular location	Nucleus
Customer validation	WB(Mus musculus, Homo sapiens)