Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | RNF123 Rabbit pAb |
---|---|
Catalog No. | A7618 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1213-1314 of human RNF123 (NP_071347.2). |
---|---|
Sequence | QSYADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA |
Gene ID | |
Swiss Prot | |
Synonyms | KPC1; FP1477; RNF123 |
Calculated MW | 149kDa |
Observed MW | 148kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549, Mouse brain, Mouse spleen |
Cellular location | Cytoplasm |
Customer validation | WB(Homo sapiens) IF(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7618? Please let us know so that we can cite the reference in this datasheet.