Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | RNF138 Rabbit pAb |
---|---|
Catalog No. | A10304 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-245 of mouse RNF138 (Q9CQE0). |
---|---|
Sequence | SVTRRERACPERALDLENIMRRFSGSCRCCSKKIKFYRMRHHYKSCKKYQDEYGVSSVIPNFKISQDSVRSSNRSETSASDNTETYQEDTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEETQYQTAVEESFQVNM |
Gene ID | |
Swiss Prot | |
Synonyms | Trif; STRIN; Trif-d; 2410015A17Rik; 2810480D20Rik |
Calculated MW | 24kDa/28kDa |
Observed MW | 28kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | BT-474 |
Cellular location | |
Customer validation | WB(Sus scrofa, Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10304? Please let us know so that we can cite the reference in this datasheet.