제품 > 항체 > 다중클론항체(pAb)

RNF149 Rabbit pAb (A24526)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Immunofluorescence analysis of C6 cells using RNF149 Rabbit pAb (A24526) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Hep G2 cells using RNF149 Rabbit pAb (A24526) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HepG2 cells using RNF149 Rabbit pAb (A24526) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RNF149 Rabbit pAb
Catalog No.	A24526
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within cellular response to xenobiotic stimulus; negative regulation of MAPK cascade; and regulation of protein stability. Located in membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human RNF149(NP_775918.2).
Sequence	SVVFVAIAFITMMIISLAWLIFYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWL
Gene ID
Swiss Prot
Synonyms	RNF149; DNAPTP2; ring finger protein 149
Calculated MW	43kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RNF149 Rabbit pAb images

Immunofluorescence - RNF149 Rabbit pAb (A24526)

Immunofluorescence analysis of HepG2 cells using RNF149 Rabbit pAb (A24526) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.