Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | RNF170 Rabbit pAb |
---|---|
Catalog No. | A15195 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 46-120 of human RNF170 (NP_001153696.1). |
---|---|
Sequence | RNVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSW |
Gene ID | |
Swiss Prot | |
Synonyms | ADSA; SNAX1; SPG85; RNF170 |
Calculated MW | 30kDa |
Observed MW | 30kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse thymus, Mouse brain, Mouse pancreas |
Cellular location | Endoplasmic reticulum membrane, Multi-pass membrane protein |
Customer validation | WB(Mus musculus) IF(Mus musculus) IP(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15195? Please let us know so that we can cite the reference in this datasheet.