제품 > 항체 > 단일클론항체(mAb)

ROCK1 Rabbit mAb (A11158)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ROCK1 Rabbit mAb (A11158) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	ROCK1 Rabbit mAb
Catalog No.	A11158
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2371

Background

This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytokinesis and plays a role in transcriptional activation by serum response factor. This protein, a downstream effector of Rho, phosphorylates and activates LIM kinase, which in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. A pseudogene, related to this gene, is also located on chromosome 18.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human ROCK1 (Q13464).
Sequence	STSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
Gene ID
Swiss Prot
Synonyms	ROCK-I; P160ROCK; ROCK1
Calculated MW	158kDa
Observed MW	158kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HT-29, Hep G2, Jurkat, C6, Mouse lung
Cellular location	Cell membrane, Cell projection, Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, bleb, centriole, centrosome, cytoskeleton, lamellipodium, microtubule organizing center, ruffle.
Customer validation	WB(Mus musculus, Rattus norvegicus) IHC(Mus musculus)