Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ROCK1 Rabbit mAb |
---|---|
Catalog No. | A11158 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2371 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human ROCK1 (Q13464). |
---|---|
Sequence | STSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY |
Gene ID | |
Swiss Prot | |
Synonyms | ROCK-I; P160ROCK; ROCK1 |
Calculated MW | 158kDa |
Observed MW | 158kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HT-29, Hep G2, Jurkat, C6, Mouse lung |
Cellular location | Cell membrane, Cell projection, Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, bleb, centriole, centrosome, cytoskeleton, lamellipodium, microtubule organizing center, ruffle. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11158? Please let us know so that we can cite the reference in this datasheet.