Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Chromatin immunoprecipitation was performed with 25 μg of cross-linked chromatin from HepG2 cells using 5 μg of RXRα Rabbit mAb (A19105). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of RXRα across chromosome 19 (upper panel) and the genomic region encompassing ECH1, a representative gene enriched in RXRα (lower panel).
Chromatin immunoprecipitation was performed with 25 μg of cross-linked chromatin from HepG2 cells using 5 μg of RXRα Rabbit mAb (A19105). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of RXRα in the representative genomic region surrounding ECH1 gene.
Western blot analysis of various lysates using RXRα Rabbit mAb (A19105) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of various lysates using RXRα Rabbit mAb (A19105) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Confocal imaging of HeLa cells using RXRα Rabbit mAb (A19105, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunoprecipitation analysis of 300 μg extracts from HepG2 cells using 3 μg RXRα antibody (A19105). Western blot was performed from the immunoprecipitate using RXRα antibody (A19105) at a dilution of 1:1000.
Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using RXRα antibody (A19105) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
| Product name | RXRα Rabbit mAb |
|---|---|
| Catalog No. | A19105 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0468 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXRα (P19793). |
|---|---|
| Sequence | MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | NR2B1; RXRalpha; RXR-alpha; RXRα |
| Calculated MW | 51kDa |
| Observed MW | 60kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | MCF7, HepG2, BxPC-3, Mouse lung, Rat lung, Rat liver |
| Cellular location | Nucleus, Cytoplasm, Mitochondrion . |
| Customer validation | (HCT116) WB(Mus musculus, Homo sapiens) IF(Homo sapiens) IP(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19105? Please let us know so that we can cite the reference in this datasheet.
