Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RXRα Rabbit mAb |
---|---|
Catalog No. | A19105 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0468 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXRα (P19793). |
---|---|
Sequence | MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP |
Gene ID | |
Swiss Prot | |
Synonyms | NR2B1; RXRalpha; RXR-alpha; RXRα |
Calculated MW | 51kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | MCF7, HepG2, BxPC-3, Mouse lung, Rat lung, Rat liver |
Cellular location | Nucleus, Cytoplasm, Mitochondrion . |
Customer validation | (HCT116) WB(Mus musculus, Homo sapiens) IF(Homo sapiens) IP(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19105? Please let us know so that we can cite the reference in this datasheet.