Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Rad21 Rabbit mAb |
---|---|
Catalog No. | A19749 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2276 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 532-631 of human Rad21 (O60216). |
---|---|
Sequence | EKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII |
Gene ID | |
Swiss Prot | |
Synonyms | MGS; HR21; MCD1; NXP1; SCC1; CDLS4; hHR21; HRAD21; Rad21 |
Calculated MW | 72kDa |
Observed MW | 130kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, A549, NIH/3T3, C6 |
Cellular location | Condensed nuclear chromosome, Cytosol, nuclear matrix, Nucleoplasm, Nucleus, Spindle pole. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19749? Please let us know so that we can cite the reference in this datasheet.