Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Rad51 Rabbit mAb |
---|---|
Catalog No. | A2829 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0764 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad51 (Q06609). |
---|---|
Sequence | MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEII |
Gene ID | |
Swiss Prot | |
Synonyms | RECA; BRCC5; FANCR; MRMV2; HRAD51; RAD51A; HsRad51; HsT16930; Rad51 |
Calculated MW | 37kDa |
Observed MW | 37kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, MCF7, Mouse testis, Rat testis |
Cellular location | Cytoplasm, Mitochondrion matrix, Nucleus, centrosome, cytoskeleton, microtubule organizing center, perinuclear region. |
Customer validation | WB(Homo sapiens, Caenorhabditis elegans) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2829? Please let us know so that we can cite the reference in this datasheet.