제품 > 항체 > 단일클론항체(mAb)

RhoA Rabbit mAb (A19106)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of HUVEC cells, using RhoA antibody (A19106) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	RhoA Rabbit mAb
Catalog No.	A19106
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0372

Background

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RhoA (P61586).
Sequence	MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT
Gene ID
Swiss Prot
Synonyms	ARHA
Calculated MW	22kDa
Observed MW	22kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HUVEC
Cellular location	Cell membrane, Cell projection, Cleavage furrow, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, cell cortex, cytoskeleton, lamellipodium
Customer validation	WB(Mus musculus)